Class: Ms::Fasta::Entry
- Inherits:
-
Object
- Object
- Ms::Fasta::Entry
- Defined in:
- lib/ms/fasta/entry.rb
Overview
Entry represents a FASTA formatted entry.
entry = Entry.parse %q{
>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY
}.strip
entry.header[0,30] # => 'gi|5524211|gb|AAD44166.1| cyto'
entry.sequence[0,30] # => 'LCLYTHIGRNIYYGSYLYSETWNTGIMLLL'
Instance Attribute Summary collapse
-
#header ⇒ Object
The header for self.
-
#sequence ⇒ Object
The sequence of self.
Class Method Summary collapse
-
.parse(str) ⇒ Object
Parses the entry string into a Fasta::Entry.
Instance Method Summary collapse
-
#dump(target = "", options = {}) ⇒ Object
Formats and dumps self to the target.
-
#initialize(header = "", sequence = "") ⇒ Entry
constructor
A new instance of Entry.
-
#lines(line_length = 70) ⇒ Object
Returns the header and sequence formated into lines of line_length or less.
-
#to_s ⇒ Object
Returns self formatted as a string.
Constructor Details
#initialize(header = "", sequence = "") ⇒ Entry
Returns a new instance of Entry.
39 40 41 42 |
# File 'lib/ms/fasta/entry.rb', line 39 def initialize(header="", sequence="") @header = header @sequence = sequence end |
Instance Attribute Details
#header ⇒ Object
The header for self
34 35 36 |
# File 'lib/ms/fasta/entry.rb', line 34 def header @header end |
#sequence ⇒ Object
The sequence of self
37 38 39 |
# File 'lib/ms/fasta/entry.rb', line 37 def sequence @sequence end |
Class Method Details
.parse(str) ⇒ Object
Parses the entry string into a Fasta::Entry. The entry string must be well-formatted, ie begin with '>'.
23 24 25 26 27 28 29 30 |
# File 'lib/ms/fasta/entry.rb', line 23 def parse(str) unless str[0] == ?> raise "input should begin with '>'" end seq_begin = str.index(/\r?\n/) Entry.new(str[1, seq_begin-1], str[seq_begin, str.length - seq_begin].gsub(/\r?\n/, "")) end |
Instance Method Details
#dump(target = "", options = {}) ⇒ Object
Formats and dumps self to the target. Use the options to modify the output:
- line_length
the length of each output line (default 70)
62 63 64 65 66 67 |
# File 'lib/ms/fasta/entry.rb', line 62 def dump(target="", ={}) line_length = .has_key?(:line_length) ? [:line_length ] : 70 target << self.lines(line_length).join("\n") target << "\n" target end |
#lines(line_length = 70) ⇒ Object
Returns the header and sequence formated into lines of line_length or less. The '>' delimiter is added to the header line.
46 47 48 49 50 51 52 53 54 55 56 57 |
# File 'lib/ms/fasta/entry.rb', line 46 def lines(line_length=70) raise ArgumentError.new("line length must be greater than 0") unless line_length > 0 lines = [">#{header}"] current = 0 while current < sequence.length lines << sequence[current, line_length] current += line_length end lines end |
#to_s ⇒ Object
Returns self formatted as a string
70 71 72 |
# File 'lib/ms/fasta/entry.rb', line 70 def to_s dump end |