
Build Status

Stockholm format file parser for ruby.


gem install bio-stockholm


An example stockholm format file, from

#=GF AC PF00571
#=GF DE CBS domain
#=GF AU Bateman A
#=GF CC CBS domains are small intracellular modules mostly found
#=GF CC in 2 or four copies within a protein.
#=GF SQ 5
#=GS O31698/18-71 AC O31698
#=GS O83071/192-246 AC O83071
#=GS O83071/259-312 AC O83071
#=GS O31698/88-139 AC O31698
#=GS O31698/88-139 OS Bacillus subtilis
#=GR O83071/192-246 SA  9998877564535242525515252536463774777
#=GR O31699/88-139 AS   ________________*____________________
#=GR O31699/88-139 IN   ____________1____________2______0____
require 'bio-stockholm'

entries = Bio::Stockholm::Reader.parse_from_file('spec/data/wikipedia.sto') #=> Array of 1

cbs = entries[0] #=> Bio::Stockholm::Store object

cbs.gf_features['ID'] #=> 'CBS'
cbs.gf_features['AC'] #=> 'PF00571'

# #=GS O31698/88-139 OS Bacillus subtilis
cbs.records['O31698/88-139'].gs_features['OS'] #=> 'Bacillus subtilis'

cbs.records['O83071/192-246'].sequence #=> 'MTCRAQLIAVPRASSLAEAIACAQKMRVSRVPVYERS'

The API doc is online. For more code examples see the test files in the source tree.

Project home page

Information on the source tree, documentation, examples, issues and how to contribute, see

The BioRuby community is on IRC server:, channel: #bioruby.


This software is currently unpublished.

This Biogem is published at (


Copyright (c) 2013 Ben J. Woodcroft. See LICENSE.txt for further details.