Class: Bio::DDBJ::XML::ClustalW

Inherits:
Bio::DDBJ::XML show all
Defined in:
lib/bio/io/ddbjxml.rb

Overview

ClustalW

Multiple seaquece alignment using ClustalW.

Examples

serv = Bio::DDBJ::XML::ClustalW.new

query = "> RABSTOUT   rabbit Guinness receptor\nLKMHLMGHLKMGLKMGLKGMHLMHLKHMHLMTYTYTTYRRWPLWMWLPDFGHAS\nADSCVCAHGFAVCACFAHFDVCFGAVCFHAVCFAHVCFAAAVCFAVCAC\n> MUSNOSE   mouse nose drying factor\nmhkmmhkgmkhmhgmhmhglhmkmhlkmgkhmgkmkytytytryrwtqtqwtwyt\nfdgfdsgafdagfdgfsagdfavdfdvgavfsvfgvdfsvdgvagvfdv\n> HSHEAVEN    human Guinness receptor repeat\nmhkmmhkgmkhmhgmhmhg   lhmkmhlkmgkhmgkmk  ytytytryrwtqtqwtwyt\nfdgfdsgafdagfdgfsag   dfavdfdvgavfsvfgv  dfsvdgvagvfdv\nmhkmmhkgmkhmhgmhmhg   lhmkmhlkmgkhmgkmk  ytytytryrwtqtqwtwyt\nfdgfdsgafdagfdgfsag   dfavdfdvgavfsvfgv  dfsvdgvagvfdv\n"

puts serv.analyzeSimple(query)
puts serv.analyzeParam(query, '-align -matrix=blosum')

WSDL Methods

  • analyzeSimple(query)

  • analyzeParam(query, param)

References

Constant Summary

SERVER_URI =
BASE_URI + "ClustalW.wsdl"

Constants inherited from Bio::DDBJ::XML

BASE_URI

Instance Attribute Summary

Attributes inherited from SOAPWSDL

#log, #wsdl

Method Summary

Methods inherited from Bio::DDBJ::XML

#initialize

Methods inherited from SOAPWSDL

#initialize, #list_methods

Constructor Details

This class inherits a constructor from Bio::DDBJ::XML

Dynamic Method Handling

This class handles dynamic methods through the method_missing method in the class Bio::SOAPWSDL